Skip to main content

Adenosine Deaminase/ADA Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-90361PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-90361PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADA.

Source: E. coli

Amino Acid Sequence: QVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPDFLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVALVGQGLQEGERDFGVKARSILCC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90361.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-90361PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Adenosine Deaminase/ADA

Adenosine deaminase is an enzyme involved in purine metabolism. It is needed for the breakdown of adenosine from food and from the turnover of nucleic acids in tissues. It irreversibly deaminates adenosine, converting it to the related nucleoside inosine by the removal of an amine group. Inosine can then be deribosylated (removed from ribose) by another enzyme called purine nucleoside phosphorylase (PNP), converting it to hypoxanthine. Mutations in the gene for adenosine deaminase causing it to not be expressed are one cause of severe combined immunodeficiency (SCID). Mutations causing it to be overexpressed are one cause of hemolytic anemia. There is some evidence that a different allelle (ADA2) may lead to autism. There are 2 isoforms of ADA: ADA1 and ADA2. ADA1 is found in most body cells, particularly lymphocytes and macrophages, where it is present not only in the cytosol but also as the ecto- form on the cell membrane attached to a protein called CD26. ADA2 has only been found in the macrophage where it co-exists with ADA1 where the two isoforms regulate the ratio of adenosine to deoxyadenosine to potentiate the killing of parasites. ADA2 is the predominant form present in human plasma and is increased in many diseases, particularly those associated with the immune system: for example rheumatoid arthritis, psoriasis and sarcoidosis. The plasma AD2 isoform is also increased in most cancers.

Long Name

Adenosine Aminohydrolase

Alternate Names

ADA, ADA1

Gene Symbol

ADA

Additional Adenosine Deaminase/ADA Products

Product Documents for Adenosine Deaminase/ADA Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Adenosine Deaminase/ADA Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...