AKR1B1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89146PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-89146PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all AKR1B1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AKR1B1.

Source: E. coli

Amino Acid Sequence: CTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89146.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89146PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: AKR1B1

Aldose reductase (also designated AKR1B1, ALDR1, ALR2 or AR) is member of the monomeric NADPH-dependent aldoketoreductase family. Aldose reductase, which has a molecular mass of 36 kDa, catalyzes the reduction of various aldehydes and has been implicated in the development of diabetic complications by catalyzing the reduction of the aldehyde form of glucose, to the corresponding sugar alcohol, sorbitol. This pathway plays a minor role in glucose metabolism in most tissues, however in diabetic hyperglycemia, cells undergoing insulin-independent uptake of glucose accumulate significant quantities of sorbitol. The resulting hyperosmotic stress to cells may be a cause of diabetic complications such as neuropathy, retinopathy, and cataracts. Aldose reductase is very similar to human aldehyde reductase, bovine prostaglandin F synthase and to the European common frog protein, rho-crystallin.

Alternate Names

ADR, Aldehyde reductase, Aldo-keto reductase family 1 member B1, aldo-keto reductase family 1, member B1 (aldose reductase), ALDR1aldose reductase, ALR2, ARaldehyde reductase 1, EC 1.1.1, EC 1.1.1.21, Lii5-2 CTCL tumor antigen, low Km aldose reductase, MGC1804

Gene Symbol

AKR1B1

Additional AKR1B1 Products

Product Documents for AKR1B1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for AKR1B1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.