ALDH18A1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-83324PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-83324PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all ALDH18A1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ALDH18A1.

Source: E. coli

Amino Acid Sequence: SVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83324.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-83324PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ALDH18A1

ALDH18A1, or Delta-1-pyrroline-5-carboxylate synthase, contains a long 88 kDa and a short 87 kDa isoform, and is involved in the catalytic conversion of glutamate to glutamate 5-semialdehyde. Current research on ALDH18A1 is being conducted to determine the relation between the protein and a variety of diseases and disorders, including neurodegeneration, pneumonia, connective tissue disease, mental retardation, hypoornithinemia, tuberculosis, microcephaly, Alzheimer's disease, gastroesophageal reflux disease, and dementia. The protein has been linked to biosynthesis and metabolic pathways where it interacts with PUS1, UQCRFS1, ICT1, OAT, and MYC.

Alternate Names

aldehyde dehydrogenase 18 family, member A1, Aldehyde dehydrogenase family 18 member A1, delta-1-pyrroline-5-carboxylate synthase, EC 2.1.2.11, EC 2.3.3.13, GSASdelta1-pyrroline-5-carboxlate synthetase, MGC117316, P5CSdelta-1-pyrroline-5-carboxylate synthetase, PYCSEC 1.2.1.41, pyrroline-5-carboxylate synthetase (glutamate gamma-semialdehyde synthetase)

Gene Symbol

ALDH18A1

Additional ALDH18A1 Products

Product Documents for ALDH18A1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ALDH18A1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.