Aly Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56154PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-56154PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all Aly Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Aly.

Source: E. coli

Amino Acid Sequence: GGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVET

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56154.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-56154PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Aly

Pre-mRNA splicing plays an important role in regulation of gene expression. During the splicing process, specific proteins are recruited to the mRNA and assembled into a complex of mRNA-protein near the exon-exon junction. This complex is termed the mRNA-protein complex (mRNP) or the exon-exon junction complex. The proteins that are found in this complex include: Y14, magoh, Aly/REF, RNPS1, Upf3, and DEK.1-5 Aly (also known as mREF1-I) is the mammalian homologue of the yeast mRNA export factor Yra1p.6-7 It is a 233 amino acid RNAbinding protein that contains a RNA-binding domain and is recruited to the mRNP complexes during the splicing. Excess of recombinant expression of Aly in the cells increases both the rate and efficiency of spliced and unspliced mRNA export (in vivo) from the nucleus to the cytoplasm. In contrast to the Y14 protein, Aly is dissociated from the mRNAs after the export to the cytoplasm.1, 5-6

Alternate Names

Ally of AML-1 and LEF-1, ALY/REF, ALYBEFbZIP enhancing factor, bZIP-enhancing factor BEF, REF, THO complex 4, THO complex subunit 4, tho4, Transcriptional coactivator Aly/REF

Gene Symbol

ALYREF

Additional Aly Products

Product Documents for Aly Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Aly Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.