Recombinant Human Amylin GST (N-Term) Protein

Name: Recombinant Human Amylin GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00003375-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00003375-P01

Submit a review

Product Datasheet / COA / SDS

Discontinued Product

H00003375-P01 has been discontinued. View all Amylin products.

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all Amylin Proteins and Enzymes »

Product Specifications

Description

Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-89 of Human IAPP

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Amylin GST (N-Term) Protein

SDS-PAGE: Recombinant Human Amylin GST (N-Term) Protein [H00003375-P01]

SDS-Page: Recombinant Human Amylin Protein [H00003375-P01]

Formulation, Preparation and Storage

H00003375-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Amylin

Islet, or insulinoma, amyloid polypeptide (IAPP, or amylin) is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. While the assosciation of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish. Recent results suggest that amylin, like the related beta-amyloid (Abeta) assosciated with Alzheimer's disease, can induce apoptotic cell-death in particular cultured cells, an effect that may be relevant to the development of type II diabetes. [provided by RefSeq]

Alternate Names

Amylin, DAPamylin, Diabetes-associated peptide, IAP, Insulinoma amyloid peptide, islet amyloid polypeptide, Islet amyloid polypeptide (diabetes-associated peptide; amylin)

Gene Symbol

IAPP

Additional Amylin Products

Product Documents for Recombinant Human Amylin GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human Amylin GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews