AP4E1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89057PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-89057PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all AP4E1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AP4E1.

Source: E. coli

Amino Acid Sequence: LMVWSVTNKSGLELKSADLEIFPAENFKVTEQPGCCLPVMEAESTKSFQYSVQIEKPFTEGNLTGFISYHMMDTHSAQLEFSVNLSLLDFIRPLKISSDDFGKLWLSFANDVKQNV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89057.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89057PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: AP4E1

AP4E1, also known as AP-4 complex subunit epsilon-1, contains a 127 kDa and a 119 kDa isoform, and is a part of a clathrin- or nonclathrin-coated vesicle, which pursues proteins from the trans-Golgi network as they move towards the endosomal-lysosomal system. Current research is being conducted to determine the relation between AP4E1 and several diseases and disorders, such as paraplegia, neuronitis, intellectual disability, spasticity, malaria, short stature, and cerebriitis. The protein is linked to intracellular protein transport and Golgi associated vesicle biogenesis, through which it interacts with AP4B1, ARF1, AP4M1, AP4S1, and ALB.

Alternate Names

Adapter-related protein complex 4 subunit epsilon-1, adaptor-related protein complex 4, epsilon 1 subunit, adaptor-related protein complex AP-4 epsilon, AP-4 adapter complex subunit epsilon, AP-4 complex subunit epsilon-1, AP-4-EPSILON, DKFZp686L12167, Epsilon subunit of AP-4, epsilon-adaptin

Gene Symbol

AP4E1

Additional AP4E1 Products

Product Documents for AP4E1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for AP4E1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.