Skip to main content

Asparagine synthetase Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-87444PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-87444PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Asparagine synthetase.

Source: E. coli

Amino Acid Sequence: QHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87444.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-87444PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Asparagine Synthetase/ASNS

Asparagine synthetase (AS) is a housekeeping enzyme responsible for the production of asparagine from aspartate and glutamine. Most mammalian cells express AS and regulate the level of activity in response to the concentration of asparagine in the medium. Certain tumor cells in contrast, exhibit little or no AS activity and rely on the surrounding medium as a source of exogenous asparagines (1). Therefore tumor cells may be selectively killed by a chemotherapeutic drug using asparaginase. This approach has been exploited in the treatment of certain cancers like childhood acute lymphoblastic leukemia (2).

Long Name

ASNS

Alternate Names

ASNSD, EC 6.3.5.4, Glutamine Dependent Asparagine Synthetase, TS11 Cell Cycle Control Protein

Gene Symbol

ASNS

Additional Asparagine Synthetase/ASNS Products

Product Documents for Asparagine synthetase Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Asparagine synthetase Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...