Ataxin-10 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-14336PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-14336PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all Ataxin-10 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATXN10.

Source: E. coli

Amino Acid Sequence: KHPESEWPFLIITDLFLKSPELVQAMFPKLNNQERVTLLDLMIAKITSDEPLTKDDIPVFLRHAELIASTF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14336.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-14336PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Ataxin-10

Pentanucleotide repeat expansions in the ATXN10/SCA10 gene have been linked to spinocerebellar ataxia type 10, a disorder that is characterized by gait ataxia, cognitive development, and seizures. ATXN10/SCA10 is an evolutionarily conserved protein whose function has not been identified. It is proposed that the repeats in ATXN10/SCA10 may form unusual RNA hairpin structures that result in toxic RNA that may have biological effects such as sequestering of proteins, activation of enzymes, and deregulation of gene expression via the RNA interference pathway. ATXN10/SCA10 is also known as ataxin-10, spinocerebellar ataxia type 10 protein, brain protein E46 homolog, E46L, and FLJ37990.

Alternate Names

ataxin 10, ataxin-10, Brain protein E46 homolog, E46L, FLJ37990, HUMEEP, SCA10spinocerebellar ataxia 10, Spinocerebellar ataxia type 10 protein

Gene Symbol

ATXN10

Additional Ataxin-10 Products

Product Documents for Ataxin-10 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Ataxin-10 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.