Skip to main content

ATP10D Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-14327PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-14327PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP10D.

Source: E. coli

Amino Acid Sequence: LFPSPILRAKHFDRLTPEERTKALKKWRGAGKMNQVTSKYANQSAGKSGRRPMPGPSAVFAMKSASSCAIEQGNLSLCETALDQGYSETKAFEMAGPS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14327.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-14327PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ATP10D

ATP10D is a gene that codes for a protein that is expressed in the placenta and is 1426 amino acids long, weighs approximately 160 kDa, and has a shorter isoform that is 1231 amino acids long and weighs approximately 139 kDa. Current research is being done on diseases and disorders related to this gene including pharyngitis. ATP10D has also been shown to have interactions with ARFGEF1, ATPA1, LARS, PAPD5, and TMED2 in pathways such as the ion channel transport and small molecule transmembrane transport pathways.

Alternate Names

ATPase, class V, type 10D, ATPVDtype IV aminophospholipid transporting ATPase, EC 3.6.3, EC 3.6.3.1, KIAA1487ATPase class V type 10D, probable phospholipid-transporting ATPase VD

Gene Symbol

ATP10D

Additional ATP10D Products

Product Documents for ATP10D Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ATP10D Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...