Recombinant Human ATP5G3 GST (N-Term) Protein

Name: Recombinant Human ATP5G3 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00000518-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00000518-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all ATP5G3 Proteins and Enzymes »

Product Specifications

Description

Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-142 of Human ATP5G3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

41.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human ATP5G3 GST (N-Term) Protein

SDS-PAGE: Recombinant Human ATP5G3 GST (N-Term) Protein [H00000518-P01]

SDS-Page: Recombinant Human ATP5G3 Protein [H00000518-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00000518-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: ATP5G3

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene is one of three genes that encode subunit c of the proton channel. Each of the three genes have distinct mitochondrial import sequences but encode the identical mature protein. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq]

Alternate Names

ATP synthase lipid-binding protein, mitochondrial, ATP synthase proteolipid P3, ATP synthase subunit 9, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9)isoform 3, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9), ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9), ATP synthase, mitochondrial, C subunit-3, ATPase protein 9, ATPase subunit c, MGC125738, P3

Gene Symbol

ATP5G3

Additional ATP5G3 Products

Product Documents for Recombinant Human ATP5G3 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human ATP5G3 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews