Recombinant Human Band 3 GST (N-Term) Protein

Name: Recombinant Human Band 3 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00006521-Q01

Novus Biologicals, part of Bio-Techne | Catalog # H00006521-Q01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

View all Band 3 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 261-360 of Human Band 3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYK

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Band 3 GST (N-Term) Protein

SDS-PAGE: Recombinant Human Band 3 GST (N-Term) Protein [H00006521-Q01]

SDS-Page: Recombinant Human Band 3 Protein [H00006521-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00006521-Q01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Band 3

The protein encoded by this gene is part of the anion exchanger (AE) family and is expressed in the erythrocyte plasma membrane, where it functions as a chloride/bicarbonate exchanger involved in carbon dioxide transport from tissues to lungs. The protein comprises two domains that are structurally and functionally distinct. The N-terminal 40kDa domain is located in the cytoplasm and acts as an attachment site for the red cell skeleton by binding ankyrin. The glycosylated C-terminal membrane-associated domain contains 12-14 membrane spanning segments and carries out the stilbene disulphonate-sensitive exchange transport of anions. The cytoplasmic tail at the extreme C-terminus of the membrane domain binds carbonic anhydrase II. The encoded protein associates with the red cell membrane protein glycophorin A and this association promotes the correct folding and translocation of the exchanger. This protein is predominantly dimeric but forms tetramers in the presence of ankyrin. Many mutations in this gene are known in man, and these mutations can lead to two types of disease: destabilization of red cell membrane leading to hereditary spherocytosis, and defective kidney acid secretion leading to distal renal tubular acidosis. Other mutations that do not give rise to disease result in novel blood group antigens, which form the Diego blood group system. Southeast Asian ovalocytosis (SAO, Melanesian ovalocytosis) results from the heterozygous presence of a deletion in the encoded protein and is common in areas where Plasmodium falciparum malaria is endemic. One null mutation in this gene is known, resulting in very severe anemia and nephrocalcinosis. [provided by RefSeq]

Alternate Names

AE 1, AE1MGC126619, Anion exchange protein 1, Anion exchanger 1, band 3 anion transport protein, BND3, CD233, CD233 antigen, DI, EMPB3, EPB3MGC126623, erythrocyte membrane protein band 3, erythroid anion exchange protein, FR, Froese blood group, MGC116750, MGC116753, RTA1A, Solute carrier family 4 member 1, solute carrier family 4, anion exchanger, member 1 (erythrocyte membraneprotein band 3, Diego blood group), solute carrier family 4, anion exchanger, number 1, SW, Swann blood group, Waldner blood group, WD, WD1, WR, Wright blood group

Gene Symbol

SLC4A1

Additional Band 3 Products

Product Documents for Recombinant Human Band 3 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human Band 3 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews