Skip to main content

beta-2 Adrenergic R/ADRB2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-90227PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-90227PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADRB2.

Source: E. coli

Amino Acid Sequence: CRSPDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90227.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-90227PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: beta-2 Adrenergic R/ADRB2

The beta-2 adrenoceptor (ADRB2) is an Adrenergic Receptor expressed in smooth muscle and metabolic tissues. Activation of this receptor induces a decrease in gastrointestinal motility, bronchodilation, vasodilation in skeletal and cardiac muscle, and glycogenolysis in liver. The beta-2 adrenoceptor is also a major lipolytic receptor in human fat cells and may be involved in obesity. Agonists of ADRB2 are most widely used for the treatment of asthma. In complex with beta-arrestin-1 and c-src, the beta-2 adrenergic receptor activates MAP kinases ERK1(MAPK3) and ERK2 (MAPK1). Expression of the beta-2 adrenoceptor has been reported in adipose, blood, brain, heart, lung, nose, pancreas, skeletal muscle, skin, and vessel. ESTs have been isolated from breast, liver, liver/spleen, placenta, and uterus libraries.

Long Name

Beta-2 Adrenergic Receptor

Alternate Names

ADRB2, ADRB2R, B2AR, beta-2 AdrenergicR, beta2 AdrenergicR

Gene Symbol

ADRB2

Additional beta-2 Adrenergic R/ADRB2 Products

Product Documents for beta-2 Adrenergic R/ADRB2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for beta-2 Adrenergic R/ADRB2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...