Borealin Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89951PEP
Key Product Details
Source
E. coli
Conjugate
Unconjugated
Applications
Antibody Competition
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDCA8.
Source: E. coli
Amino Acid Sequence: PLKSAKTRKVIQVDEMIVEEEEEEENERKNLQTARVKRCPPSKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVSMVKPTPGLTPRFDSR
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Antibody Competition (10 - 100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89951.
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation and Storage
NBP1-89951PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: Borealin
Borealin has been shown to interact with Aurora B and survivin (BIRC5). Knockdown of Borealin by small interfering RNA resulted in severe chromosome misalignment at metaphase and accumulation of multiple interphase nuclei. Borealin is also related to the proliferation of human embryonic stem (hES) cells and is highly expressed in mouse undifferentiated ES cells.
Borealin antibodies are useful tools for stem cell studies and cell division research.
Alternate Names
BOR, borealin, cell division cycle associated 8, Cell division cycle-associated protein 8, Dasra B, DasraB, Dasra-B, FLJ10468, FLJ12042, hDasra-B, MESRGP, PESCRG3, Pluripotent embryonic stem cell-related gene 3 protein
Gene Symbol
CDCA8
Additional Borealin Products
Product Documents for Borealin Recombinant Protein Antigen
Product Specific Notices for Borealin Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...