BORIS Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89947PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-89947PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all BORIS Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CTCFL.

Source: E. coli

Amino Acid Sequence: DGVCREKDHRSPSELEAQRTSGAFQDSVLEEEVELVLAPSEESEKYILTLQTVHFTSEAVELQDMSLLSIQQQEGVQVVVQQPGPGLLWLEEGPRQSLQQCVAISIQQELYSPQEMEVLQFHALEENVMVASEDSKLAVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89947.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89947PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: BORIS

BORIS (Brother of the Regulator of Imprinted Sites) also known as CCTC-binding factor-like protein, is normally only expressed in the testis and expressed in a mutually exclusive manner with CTCF during male germ cell development. However, previous studies have shown that BORIS is abnormally activated in a wide range of human cancers. Expression of BORIS in normally BORIS-negative cells promotes cell growth that may lead to transformation. BORIS maps to the cancer-associated amplification region thought to contain an oncogene or dominant-immortalizing gene. BORIS is a candidate protein for the epigenetic reprogramming factor acting in the male germ line. BORIS is found in both the nucleus and cytoplasm.

Alternate Names

BORISHMGB1L1, BORIS-like protein, Brother of the regulator of imprinted sites, Cancer/testis antigen 27, CCCTC-binding factor, CCCTC-binding factor (zinc finger protein)-like, CT27MGC163358, CTCF paralog, CTCF-like protein, CTCF-T, dJ579F20.2, HMG-1L1, MGC169105, MGC169106, putative high mobility group protein 1-like 1, putative high mobility group protein B1-like 1, transcriptional repressor CTCFL, Zinc finger protein CTCF-T

Gene Symbol

CTCFL

Additional BORIS Products

Product Documents for BORIS Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for BORIS Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.