Skip to main content

BTAF1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-57414PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-57414PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BTAF1.

Source: E. coli

Amino Acid Sequence: QFAARYGKPILASRDARSSSREQEAGVLAMDALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCTLSPLQVQLYEDFAKSRAKCDVDETVSSATLS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57414.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-57414PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: BTAF1

BTAF1 is a member of the SNF2-like family of ATPases that associates with the TATA-binding protein (TBP) and TAFII170 (TAF172) to form the B-TF-IID complex. As part of the general transcription machinery, BTAF1 acts as a regulator of TBP and RNA polymerase II transcription. Alternate names for BTAF1 include BTAF-1, RNA polymerase II, B-TFIID transcription factor-associated, 170kDa, TAF172, TBP-associated factor 172, TAFII170, B-TFIID transcription factor-associated, 170kDa, and MOT1.

Alternate Names

ATP-dependent helicase BTAF1, BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170kDa (Mot1homolog, S. cerevisiae), B-TFIID transcription factor-associated 170 kDa subunit, EC 3.6.1, EC 3.6.4.-, MOT1MGC138406, TAF(II)170KIAA0940, TAF-172, TAF172BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170 kD (Mot1homolog, S. cerevisiae), TAFII170TATA-binding protein-associated factor 172, TBP-associated factor 172

Gene Symbol

BTAF1

Additional BTAF1 Products

Product Documents for BTAF1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for BTAF1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...