CACNA2D2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-81501PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-81501PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all CACNA2D2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CACNA2D2.

Source: E. coli

Amino Acid Sequence: EAWAEKFKVLASNRTHQDQPQKCGPNSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQVGRFFSEVDANLMLALYN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81501.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-81501PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CACNA2D2

The CACNA2D2 gene encodes a voltage-dependent calcium channel subunit alpha-2/delta-2 protein that exists in 5 isoforms: isoform 1: 1,150 amino acids long, 129 kDA; isoform 2: 1,143 amino acids long, 129 kDA; isoform 3: 1,145 amino acids long, 129 kDA; isoform 4: 1,076 amino acids long, 122 kDA; and isoform 5: 1,152 amino acids long, 130 kDA. These proteins are critical in calcium current density and in activation and inactivation kinetics of the calcium channel. Additionally, these proteins function as regulatory subunits for P/Q-type calcium channel, N-type, and L-type, as well as T-type. Overexpression of this gene triggers apoptosis. The CACNA2D2 gene participates in transcription of the CREB pathway, the caspase cascade, Fc-GammaR pathway, BMP and PDGF pathways, regulation of insulin secretion, and transmission across chemical synapses. It is known to interact with genes DLG4, CACNA1C, CACNA1D, CACNA1F, and YWHAB. The CACNA2D2 gene is associated with ataxia, seizures, lung cancer, and neuronitis.

Long Name

Voltage-dependent calcium channel subunit alpha-2/delta-2

Alternate Names

KIAA0558

Gene Symbol

CACNA2D2

Additional CACNA2D2 Products

Product Documents for CACNA2D2 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CACNA2D2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.