Recombinant Human Calpain 3 GST (N-Term) Protein

Name: Recombinant Human Calpain 3 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00000825-Q01

Novus Biologicals, part of Bio-Techne | Catalog # H00000825-Q01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all Calpain 3 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 210-309 of Human Calpain 3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Calpain 3 GST (N-Term) Protein

SDS-PAGE: Recombinant Human Calpain 3 GST (N-Term) Protein [H00000825-Q01]

SDS-Page: Recombinant Human Calpain 3 Protein [H00000825-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00000825-Q01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Calpain 3

Calpain, a heterodimer consisting of a large and a small subunit, is a major intracellular protease, although its function has not been well established. This gene encodes a muscle-specific member of the calpain large subunit family that specifically binds to titin. Mutations in this gene are associated with limb-girdle muscular dystrophies type 2A. Alternate promoters and alternative splicing result in multiple transcript variants encoding different isoforms and some variants are ubiquitously expressed. [provided by RefSeq]

Alternate Names

calpain 3, (p94), Calpain L3, Calpain p94, calpain, large polypeptide L3, calpain-3, CANP 3, CANP3MGC4403, CANPL3, EC 3.4.22, EC 3.4.22.54, LGMD2, LGMD2A, MGC10767, MGC11121, MGC14344, Muscle-specific calcium-activated neutral protease 3, muscle-specific calcium-activated neutral protease 3 large subunit, NCL1, nCL-1large [catalytic] subunit, New calpain 1

Gene Symbol

CAPN3

Additional Calpain 3 Products

Product Documents for Recombinant Human Calpain 3 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human Calpain 3 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews