Skip to main content

CD34 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38322PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-38322PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD34.

Source: E. coli

Amino Acid Sequence: LMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38322.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-38322PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CD34

CD34, also known as Cluster of Differentiation 34, is a transmembrane phosphoglycoprotein that is primarily known for being a surface marker for hematopoietic stem cells (HSCs) and progenitor cells (1,2). The CD34 protein consists of a heavily glycosylated extracellular domain, a single-pass transmembrane helix, and a cytoplasmic tail with PDZ binding motifs (1,3). Human CD34 has two protein isoforms consisting of 385 amino acids (aa) for the canonical isoform and 328 aa for isoform 2 (3,4). The canonical CD34 isoform has calculated theoretical molecular weight of 40 kDa and an observed molecular weight of ~115 kDa (1,3,4). L-Selectin (CD62L) is the most common ligand for CD34, but it has also been shown to bind CrkL (1,3).

CD34 has commonly been used as a marker for the diagnosis and classification of various diseases and pathologies including leukemia and solitary fibrous tumor (SFT) (2,5). In terms of immunohistochemistry and histopathology, CD34 has been the most common marker for SFT and is expressed in ~79% of cases (5). In addition to its use as a cell marker, CD34-postive (CD34+) hematopoietic stem cells have been used therapeutically in patients following radiation or chemotherapy due to their regenerative potential (6). There are several clinical trials showing promising results for CD34+ cell therapy for cardiovascular diseases including heart failure, ischemia, dilated cardiomyopathy, acute myocardial infarction, and angina (6). Besides hematopoietic lineages, CD34 is also expressed in non-hematopoietic cells including mesenchymal stem cells, endothelial cells and progenitors, fibrocytes, muscle satellite cells, and some cancer stem cells (1,3). While the clinical and cell therapy applications of CD34 as a cell marker is well documented, the function of CD34 is less understood but has been implicated in many cellular processes such as adhesion, proliferation, signal transduction, differentiation, and progenitor phenotype maintenance (1,3).

References

1. Sidney, L. E., Branch, M. J., Dunphy, S. E., Dua, H. S., & Hopkinson, A. (2014). Concise review: evidence for CD34 as a common marker for diverse progenitors. Stem cells (Dayton, Ohio), 32(6), 1380-1389. https://doi.org/10.1002/stem.1661

2. Krause, D. S., Fackler, M. J., Civin, C. I., & May, W. S. (1996). CD34: structure, biology, and clinical utility. Blood, 87(1), 1-13

3. Kapoor, S., Shenoy, S. P., & Bose, B. (2020). CD34 cells in somatic, regenerative and cancer stem cells: Developmental biology, cell therapy, and omics big data perspective. Journal of cellular biochemistry, 121(5-6), 3058-3069. https://doi.org/10.1002/jcb.29571

4. Uniprot (P28906)

5. Davanzo, B., Emerson, R. E., Lisy, M., Koniaris, L. G., & Kays, J. K. (2018). Solitary fibrous tumor. Translational gastroenterology and hepatology, 3, 94. https://doi.org/10.21037/tgh.2018.11.02

6. Prasad, M., Corban, M. T., Henry, T. D., Dietz, A. B., Lerman, L. O., & Lerman, A. (2020). Promise of autologous CD34+ stem/progenitor cell therapy for treatment of cardiovascular disease. Cardiovascular research, 116(8), 1424-1433. https://doi.org/10.1093/cvr/cvaa027

Alternate Names

CD34, HPCA1

Gene Symbol

CD34

Additional CD34 Products

Product Documents for CD34 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CD34 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...