Cdc14A Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-84573PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-84573PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all Cdc14A Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDC14A.

Source: E. coli

Amino Acid Sequence: QQHFLEEKQASLWVQGDIFRSKLKNRPSSEGSINKILSGLDDMSIGGNLSKTQNMERFGEDNLEDDDVEMKNGITQGDKLRAL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84573.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-84573PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Cdc14A

Overproduction of hCdc14A leads to progressive cell death, accompanied by accumulation of pre-G1 DNA fragments and gradual elimination of cells at the G2/M transition. In 50% of the mitotic cells, multipolar mitotic spindles and misaggregated chromosomes are found. hCdc14A localizes to the centrosomes at the cell-cycle interphase stage. When the cell enters mitosis, this localization disappears suggesting that hCdc14A dissociates from the centrosomes at the G2/M transition. hCdc14A localizes to interphase centrosomes, but not to mitotic centrosomes, while hCdc14B localizes to the interphase nucleolus. Thus each isoform regulates separate cell cycle events. Cdc14A may affect cell cycle progression by its ability to dephosphorylate p53 at Ser315. This phosphatase activity is mediated by the interaction between the N-terminus of hCdc14A and the C-terminus of p53.

Alternate Names

CDC10 (cell division cycle 10, S. cerevisiae, homolog), cdc14, CDC14 cell division cycle 14 homolog A, CDC14 cell division cycle 14 homolog A (S. cerevisiae), Cdc14A1, Cdc14A2, dual specificity protein phosphatase CDC14A, EC 3.1.3.16, EC 3.1.3.48, hCDC14

Gene Symbol

CDC14A

Additional Cdc14A Products

Product Documents for Cdc14A Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Cdc14A Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.