CDK5 Activator 1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-55112PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-55112PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all CDK5 Activator 1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDK5 Activator 1.

Source: E. coli

Amino Acid Sequence: FITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55112.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-55112PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CDK5 Activator 1

The baculoviruses are a large, diverse family of DNA viruses that have evolved a number of mechanisms to manipulate thier insect hosts. One of these is the ability to regulate apoptosis during infection by expressing proteins that can inhibit caspase activation, including the caspase inhibitor p35 and the inhibitor of apoptosis (IAP) proteins (reviewed in Clem, 2005; Clarke and Clem, 2003; and Iller, 1997). The p35 baculovirus protein strongly inhibits caspase enzymatic activity, and is the the most broadly acting caspase inhibitor protein known. p35 baculovirus forms essentially irreversible complexes with its target caspases in a process that is accompanied by the cleavage of p35, generating two fragments of approximately 10 kDa and 25 kDa. These cleavage fragments remain associated with caspases and thereby block caspase activity. The ability of p35 to inhibit caspases along with the central role of caspases in the apoptotic process enables p35 baculovirus to block apoptosis in a phylogentically broad range of cells, and in response to a wide variety of apoptotic induction signals. For example, over expression of p35 in mammalian, insect, and nematode cells results in resistance to apoptosis. IMG-5740 recognizes p35 baculovirus; p35 baculovirus migrates at ~35 kDa on SDS-PAGE.

Long Name

Cyclin-dependent Kinase 5, Regulatory Subunit 1 (p35)

Alternate Names

CDK5P35, CDK5R1, NCK5A, Neuronal CDK5 Activator, p35nck5a, TPKII Regulatory Subunit

Gene Symbol

CDK5R1

Additional CDK5 Activator 1 Products

Product Documents for CDK5 Activator 1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CDK5 Activator 1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.