CENPF Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56124PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-56124PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all CENPF Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CENPF.

Source: E. coli

Amino Acid Sequence: CISELSFSGPNALVPMDFLGNQEDIHNLQLRVKETSNENLRLLHVIEDRDRKVESLLNEMKELDSKLHLQEVQLMTKIEACIELEKIVGELKKENSDLSEKLEYFSCDHQEL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56124.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-56124PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CENPF

CENPF (Centromere protein F) is required for proper chromosome segregation in mitosis, and has a cell-cycle distribution that is both temporally regulated and diverse in terms of the structural component localization. Specifically, CENPF is a component of the nuclear matrix during the G2 phase of interphase. In late G2, it associates with the kinetochore and maintains this association through early anaphase. Here, CENPF is required for kinetochore function and appears to be the earliest member to interact with the centromere-kinetochore complex. It then localizes to the spindle midzone in late anaphase and to the intracellular bridge in telophase, where the protein is subsequently degraded. Given this diversity of function, CENPF is expected to play an important role in several mitotic events.

Alternate Names

AH antigen, cell-cycle-dependent 350K nuclear protein, CENF, CENP-F, CENP-F kinetochore protein, centromere protein F, centromere protein F (350/400kD, mitosin), centromere protein F, 350/400ka (mitosin), centromere protein F, 350/400kDa (mitosin), hcp-1, Kinetochore protein CENPF, Mitosin, PRO1779

Gene Symbol

CENPF

Additional CENPF Products

Product Documents for CENPF Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CENPF Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.