Recombinant Human Claudin-6 GST (N-Term) Protein

Name: Recombinant Human Claudin-6 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00009074-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00009074-P01

Submit a review

Product Datasheet / COA / SDS

Discontinued Product

H00009074-P01 has been discontinued. View all Claudin-6 products.

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

View all Claudin-6 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-220 of Human CLDN6

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAVIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

49.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Claudin-6 GST (N-Term) Protein

SDS-PAGE: Recombinant Human Claudin-6 GST (N-Term) Protein [H00009074-P01]

SDS-Page: Recombinant Human Claudin-6 Protein [H00009074-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00009074-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Claudin-6

The claudin superfamily consists of many structurally related proteins in humans. These proteins are important structural and functional components of tight junctions in paracellular transport. Claudins are located in both epithelial and endothelial cells in all tight junction-bearing tissues. Three classes of proteins are known to localize to tight junctions, including the claudins, Occludin and junction adhesion molecule. Claudins, which consist of four transmembrane domains and two extracellular loops make up tight junction strands. Claudin expression is often highly restricted to specfic regions of different tissues and may have an important role in transcellular transport through tight junctions. Claudin-6 is expressed in differentiated F9 cells that resemble tight junction-bearing viceral endoderm resulting from stimulation with retinoc acid and mediated by RXRalpha and RARgamma. Claudin-6 is absent in mouse brain and lung. The human claudin-6 gene maps to chromosome 16p13.3.

Alternate Names

Claudin6, CLDN6, Skullin 2

Gene Symbol

CLDN6

Additional Claudin-6 Products

Product Documents for Recombinant Human Claudin-6 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human Claudin-6 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews