Skip to main content

CLCC1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-82793PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-82793PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLCC1.

Source: E. coli

Amino Acid Sequence: PPQALRPRDRRRQEEIDYRPDGGAGDADFHYRGQMGPTEQGPYAKTYEGRREILRERDVDLRFQTGNKSPEVLRAFDVPDAEAREHPTVVPSHKSPVLDTKPKE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82793.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-82793PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CLCC1

Chloride channels (CLCs) regulate cellular traffic of chloride ions, a critical component of all living cells. CLCs are involved in membrane potential stabilization, signal transduction, cell volume regulation and organic solute transport. CLCC1 (Chloride channel CLIC-like protein 1), also known as MCLC (Mid-1-related chloride channel) or KIAA0761, is a 551 amino acid multi-pass membrane protein that belongs to the chloride channel MCLC family. CLCC1 is related to the Saccharomyces cerevisiaeprotein Mid-1 and is believed to function as an intracellular chloride channel that is expressed in lung, brain, muscle, liver and testis. Localizing to intracellular compartments such as the Golgi apparatus, the endoplasmic reticulum (ER) and the nuclear envelope, CLCC1 is expressed as four isoforms due to alternative splicing events, namely hMCLC-1, hMCLC-2, hMCLC-3 and hMCLC-4.

Alternate Names

chloride channel CLIC-like 1, KIAA0761, MCLCchloride channel CLIC-like protein 1, Mid1-related chloride channel, Mid-1-related chloride channel 1, Mid-1-related chloride channel protein 1

Gene Symbol

CLCC1

Additional CLCC1 Products

Product Documents for CLCC1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CLCC1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...