Complement C5 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-84395PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-84395PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all Complement C5 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C5.

Source: E. coli

Amino Acid Sequence: LLVKQLRLSMDIDVSYKHKGALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSDYKRIVACASYKPSREESSSGSSHAVMDISLPTGI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84395.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-84395PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Complement C5

C5 is synthesised in the liver as a single polypeptide chain. Before secretion the molecule is glycosylated and secreted into plasma as a 190kDa glycoprotein consisting of a disulphide linked alpha-chain (115kDa) and beta-chain (75kDa). C5 occurs in plasma at about 75mg/L. It is activated via either the classical or the alternative complement pathway, by protoelytic cleavage of C5a (11.5kDa) from the N-terminal of the alpha-chain. C5a is a potent anaphylotoxin and stimulates directed migration of neutrophils, eosinophils, basophils and monocytes. The other fragment, C5b,initiates the assembly of the membrane attack complex that mediates the cytolysis of viral and bacterial pathogens.

Alternate Names

anaphylatoxin C5a analog, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4, C5, complement C5, complement component 5, CPAMD4MGC142298, FLJ17816, FLJ17822

Gene Symbol

C5

Additional Complement C5 Products

Product Documents for Complement C5 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Complement C5 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.