Skip to main content

CPI17 alpha Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-37897PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-37897PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP1R14A.

Source: E. coli

Amino Acid Sequence: VKYDRRELQRRLDVEKWIDGRLEELYRGMEADMPDEINIDELLELESEEERSR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-37897.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-37897PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CPI17 alpha

PKC Potentiated Inhibitor Protein-17 (CPI-17) is a 17 kDa protein (1). Expressed in smooth muscles and neuronal cells, CPI-17 is a myosin phosphatase inhibitor protein. Phosphorylation of CPI-17 at Thr38 enhances its inhibitory effect by 100 fold (2). Once phosphorylated, CPI-17 inhibits PP1c and MLCP holoenzyme activity (3).

Alternate Names

17 kDa PKC-potentiated inhibitory protein of PP1, CPI-1717-kDa PKC-potentiated inhibitory protein of PP1, CPI1717-KDa protein, PKC-potentiated inhibitory protein of PP1, PPP1INL, Protein kinase C-potentiated inhibitor protein of 17 kDa, protein phosphatase 1 regulatory subunit 14A, protein phosphatase 1, regulatory (inhibitor) subunit 14A

Gene Symbol

PPP1R14A

Additional CPI17 alpha Products

Product Documents for CPI17 alpha Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CPI17 alpha Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...