Skip to main content

Defensin alpha 4 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-13910PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-13910PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DEFA4.

Source: E. coli

Amino Acid Sequence: SSALQVSGSTRGMVCSCRLVFCRRTELRVGNCLIGGVSFTYCCTRVD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13910.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-13910PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Defensin alpha 4

Human neutrophil alpha-defensins (also designated HNPs) are small, cationic, cysteine-rich antimicrobial proteins that play important roles in innate immunity against infectious microbes such as bacteria, fungi and enveloped viruses. Alpha-defensins are synthesized as inactive precursors and are activated by proteolytic cleavage by MMP-7. Paneth cells in small intestinal crypts secrete the alpha-defensins, which are also termed cryptidins in mice. The cryptidin-4 gene is unique among the Paneth cell alpha defensins in that it is inactive in the duodenum, but expressed at maximal levels in the distal small bowel.

Alternate Names

corticostatin, DEF4, defensin, alpha 4, corticostatin, defensin, alpha 4, preproprotein, HNP-4, HP4, HP-4, MGC120099, MGC138296, neutrophil defensin 4

Gene Symbol

DEFA4

Additional Defensin alpha 4 Products

Product Documents for Defensin alpha 4 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Defensin alpha 4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...