Recombinant Human DLST GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00001743-P01

Novus Biologicals, part of Bio-Techne
Discontinued Product
H00001743-P01 has been discontinued. View all DLST products.

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all DLST Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-453 of Human DLST

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

75.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human DLST GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00001743-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: DLST

DLST, also known as Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, is a 48.8 kDa, 453 amino acid protein that is involved in catalyzing the reaction of 2-oxoglutarate into succinyl-CoA and carbon dioxide. Current research is investigating the effect of the protein on malaria, neurodegeneration, pneumonia, cat-scratch disease, ataxia, prostatitis, Parkinson's disease, and Alzheimer's disease. The protein is involved in lysine degradation, citric acid cycle (TCA cycle), and metabolism pathways where it interacts with FLII, ATP6V1B2, HSPD1, UMPS, and DDOST.

Alternate Names

2-oxoglutarate dehydrogenase complex component E2, dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutaratecomplex), Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenasecomplex, dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutaratedehydrogenase complex, mitochondrial, DLTS, E2K, EC 2.3.1, EC 2.3.1.61, OGDC-E2

Gene Symbol

DLST

Additional DLST Products

Product Documents for Recombinant Human DLST GST (N-Term) Protein

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human DLST GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.