Skip to main content

DOK1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-55613PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-55613PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DOK1.

Source: E. coli

Amino Acid Sequence: AQGNDIFQAVETAIHRQKAQGKAGQGHDVLRADSHEGEVAEGKLPSPPGPQELLDSPPALYAEPLDSLRIAPCPSQDSLYSDPLDSTSAQAGEGVQRKKPLYWDLYEHAQQQLLKAKLTDPKEDPIYDEPEG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55613.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-55613PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: DOK1

Dok-1 associates with the Ras GTPase-activating protein (Ras GAP) upon tyrosine phosphorylation. Evidence suggests that Dok-1 (also designated p62dok) is a substrate of the constitutive tyrosine kinase activity of p210 Bcr-Abl, a fusion protein caused by the t(9;22) translocation and associated with chronic myelogenous leukemia. Dok-1, as well as the tyrosine kinase substrates IRS-1 and Cas, are members of a class of "docking" proteins which contain multiple tyrosine residues and putative SH2 binding sites. Dok-1 is suspected to be the substrate phosphorylated in response to stimulation by a number of growth factors, including PDGF, VEGF, insulin and IGF. Dok-2 (also designated p56dok) has also been identified as a potential mediator of the effects of p210 Bcr-Abl.

Alternate Names

docking protein 1, docking protein 1 (downstream of tyrosine kinase 1), docking protein 1, 62kD (downstream of tyrosine kinase 1), docking protein 1, 62kDa (downstream of tyrosine kinase 1), Downstream of tyrosine kinase 1, MGC117395, MGC138860, p62(dok), p62dok, pp62

Gene Symbol

DOK1

Additional DOK1 Products

Product Documents for DOK1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for DOK1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...