Recombinant Human Dopamine D5R/DRD5 Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00001816-G01

Novus Biologicals, part of Bio-Techne
Discontinued Product
H00001816-G01 has been discontinued. View all Dopamine D5R/DRD5 products.

Key Product Details

Source

Wheat germ

Conjugate

Unconjugated

Applications

Affinity Purification

View all Dopamine D5R/DRD5 Proteins and Enzymes »

Product Specifications

Description

An untagged recombinant protein corresponding to the amino acid sequence of (ABM82859.1) for Human Dopamine D5 R/DRD5

Source: Wheat Germ (in vitro) with proprietary liposome technology

Amino Acid Sequence: MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVLVCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFDIMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNWHRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYAFNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

52.47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Formulation, Preparation and Storage

H00001816-G01
Preparation Method in vitro wheat germ expression system with proprietary liposome technology
Formulation 25 mM Tris-HCl pH8.0 in 2% glycerol.
Preservative Glycerol
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Dopamine D5R/DRD5

The members of the G protein-coupled receptor family are distinguished by their slow transmitting response to ligand binding. These seven transmembrane proteins include the adrenergic, serotonin, and dopamine receptors. The effect of the signaling molecule can be excitatory or inhibitory depending on the type of receptor to which it binds. Beta-adrenergic receptor bound to adrenaline activates adenylyl cyclase, while alpha 2-adrenergic receptor bound to adrenaline inhibits adenylyl cyclase. The dopamine receptors are divided into two classes; D1 and D2, which differ in their functional characteristics. D1 receptors stimulate adenylyl cyclase, while D2 receptors inhibit adenylyl cyclase activity. Five different subtypes of dopamine receptor have been described to date. D1DR and D5DR belong to the D1 subclass, while D2DR, D3DR and D4DR belong to the D2 subclass of dopamine receptors.

Long Name

Dopamine D5 Receptor

Alternate Names

DBDR, Dopamine D5 R, DRD1B, DRD1L2, DRD5

Gene Symbol

DRD5

Additional Dopamine D5R/DRD5 Products

Product Documents for Recombinant Human Dopamine D5R/DRD5 Protein

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human Dopamine D5R/DRD5 Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.