Recombinant Human DYNC1H1 GST (N-Term) Protein

Name: Recombinant Human DYNC1H1 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00001778-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00001778-P01

Submit a review

Product Datasheet / COA / SDS

Discontinued Product

H00001778-P01 has been discontinued. View all DYNC1H1 products.

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

View all DYNC1H1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-197 of Human DYNC1H1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MISKMLKMQMLEDEDDLAYAETEKKTRTDSTSDGRPAWMRTLHTTASNWLHLIPQTLSHLKRTVENIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQVCEGKKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQNISLAAASGGAKELKVKALLTSLGWSAAVLGWGGSGSGEKHRAQV

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

48.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human DYNC1H1 GST (N-Term) Protein

SDS-PAGE: Recombinant Human DYNC1H1 GST (N-Term) Protein [H00001778-P01]

SDS-Page: Recombinant Human DYNC1H1 Protein [H00001778-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00001778-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: DYNC1H1

The DYNC1H1 gene encodes a cytoplasmic dynein 1 heavy chain 1 protein that is 4,646 amino acids long at 532 kDA. Dyneines function as molecular motors that contain ATPase activity. Defects in DYNC1H1 cause Charcot-Marie-Tooth Disease type 2O (CMT2O), mental retardation autosomal dominant type 13 (MRD13), as well as spinal muscular atrophy, lower extremity, autosomal dominant (SMALED). DYNC1H1 has also been investigated by researchers in myeloma, neuropathy, ciliary dyskinesia, lateral sclerosis, intellectual disabilities, lissencephaly, schizophrenia, malaria, and neurodegeneration. DYNC1H1 participates in centrosome maturation, adaptive immune system, cytoplasmic microtubules, cell cycle spindle assembly and chromosome separation, as well as phagosome and vasopressin-regulated water reabsorption. DYNC1H1 interacts with genes HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, and HIST1H43.

Alternate Names

cytoplasmic dynein 1 heavy chain 1, Cytoplasmic dynein heavy chain 1, DHC1a, DHC1Dynein heavy chain, cytosolic, DKFZp686P2245, Dnchc1, DNCLDNCH1, DNECLDYHC, dynein, cytoplasmic 1, heavy chain 1, dynein, cytoplasmic, heavy polypeptide 1, HL-3, KIAA0325, p22

Gene Symbol

DYNC1H1

Additional DYNC1H1 Products

Product Documents for Recombinant Human DYNC1H1 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human DYNC1H1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews