Skip to main content

E2F5 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-17704PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-17704PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human E2F5

Source: E. coli

Amino Acid Sequence: GCNTKEVIDRLRYLKAEIEDLELKERELDQQKLWLQQSIKNVMDDSINNRF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17704.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-17704PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: E2F5

The protein encoded by the E2F5 gene is a member of the E2F family of transcription factors. The E2F family plays a crucialrole in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transformingproteins of small DNA tumor viruses. The E2F proteins contain several evolutionarily conserved domains that arepresent in most members of the family. These domains include a DNA binding domain, a dimerization domain whichdetermines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domainenriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within thetransactivation domain. This protein is differentially phosphorylated and is expressed in a wide variety of humantissues. It has higher identity to E2F4 than to other family members. Both this protein and E2F4 interact with tumorsuppressor proteins p130 and p107, but not with pRB. Alternative splicing results in multiple variants encodingdifferent isoforms. (provided by RefSeq)

Alternate Names

E2F transcription factor 5, p130-binding, E2F-5, transcription factor E2F5

Gene Symbol

E2F5

Additional E2F5 Products

Product Documents for E2F5 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for E2F5 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...