EBI3 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-48852PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-48852PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all EBI3 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL-27/IL-35 EBI3 Subunit.

Source: E. coli

Amino Acid Sequence: SPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48852.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-48852PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: EBI3

EBI3 gene encodes a 229 amino acid long, 25 kDA interleukin-27 subunit beta protein that is member to the hematopoitetin receptor family. These proteins obtain pro as well as anti-inflammatory properties and have roles in T-helper cell development, suppressing cell proliferation, encouraging cytotoxic T-cell activity, and can induce isotope switching in B cells. EBI3 participates in Th1 differentiation, IL-2 signaling (and its primary biological effects in various immune cells), as well as IL27-mediated signaling events. EBI3 interacts with genes IL27, IL12A, CANX, MDF1, and SMAD3. It has been associated and researched in sepsis, asthma, carcinoma, Chron's disease, b-cell lymphomas, ulcerative colitis, Hodgkin disease, lymphoma, ebv infections, and glomerulonephritis.

Long Name

Epstein-Barr virus induced gene 3

Alternate Names

EBI-3, IL-27 beta, IL-27B, IL-35 EBI3, IL35 EBI3

Gene Symbol

EBI3

Additional EBI3 Products

Product Documents for EBI3 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for EBI3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.