Skip to main content

EGF-L6 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-33282PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-33282PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EGFL6.

Source: E. coli

Amino Acid Sequence: CSFNHGICDWKQDREDDFDWNPADRDNAIGFYMAVPALAGHKKDIGRLKLLLPDLQPQSNFCLLFDYRLAGDKVGKLRVFVKNSNNALAWEKTTSEDEKWKTGKIQLYQGTDATKSIIFEAERGKGKTGEIAVDGVLLVSGLCPD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33282.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-33282PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: EGF-L6

The EGFL6 gene encodes an epidermal growth factor-like protein 6 with isoform 1 having 553 amino acids in length at 61 kDA and isoform 2 at 554 amino acids in length at 61 kDA. Member sof the epidermal growth factor (EGF) repeat family are known to be involved in the regulation of cell cycle, proliferation, and developmental processes. This protein encourages matrix assembly and aids in binding integrin alpha-8/beta-1, playing a role in hair follicle morphogenesis and is known to interact with genes SH3GL3 and SH3GL2. EGFL6 has been linked to detrusor sphincter dyssynergia, benign meningioma, bladder diverticulum, lung meningioma, and obesity.

Long Name

EGF-like Domain, Multiple 6

Alternate Names

EGFL6, MAEG

Gene Symbol

EGFL6

Additional EGF-L6 Products

Product Documents for EGF-L6 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for EGF-L6 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...