Recombinant Human eIF3e GST (N-Term) Protein

Name: Recombinant Human eIF3e GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00003646-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00003646-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all eIF3e Proteins and Enzymes »

Product Specifications

Description

Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1- 445 of Human EIF3S6 ( NP_001559.1).

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY

Purity

>80% by SDS-PAGE and Coomassie blue staining

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Formulation, Preparation and Storage

H00003646-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: eIF3e

Int6 is a candidate tumor suppressor in multiple neoplasms, and in particular, breast and lung cancers. The Int6 locus was initially identified as a common insertion site (CIS) in a genetic screen for transforming sequences in a breast cancer mouse model system. Insertion of mouse mammary tumor virus (MMTV) into this locus results in the production of an amino-terminal truncated gene product. Expression of the truncated Int6 product corresponds to cellular transformation in both in vivo and in vitro systems. This gene product plays a role in regulating translation initiation and is a component of the eIF3 translation initiation complex. There is evidence that suggests that Int6 may impart a negative role in the general translational machinery while promoting an increase in the expression of a subset of stressresponsive genes. Taken together, it is of great interest to further study the mechanism by which Int6 is involved in regulating cell growth.

Alternate Names

eIF-3 p48, eIF3e, eIF3-p48, EIF3S6EIF3-P48, Eukaryotic translation initiation factor 3 subunit 6, eukaryotic translation initiation factor 3 subunit E, eukaryotic translation initiation factor 3, subunit 6 (48kD), eukaryotic translation initiation factor 3, subunit 6 48kDa, eukaryotic translation initiation factor 3, subunit E, INT6eIF3-p46, mammary tumor-associated protein INT6, murine mammary tumor integration site 6 (oncogene homolog), Viral integration site protein INT-6 homolog

Gene Symbol

EIF3E

Additional eIF3e Products

Product Documents for Recombinant Human eIF3e GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human eIF3e GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews