Recombinant Human ELF5 GST (N-Term) Protein

Name: Recombinant Human ELF5 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00002001-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00002001-P01

Submit a review

Product Datasheet / COA / SDS

Discontinued Product

H00002001-P01 has been discontinued. View all ELF5 products.

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all ELF5 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-255 of Human ELF5

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MLDSVTHSTFLPNASFCDPLMSWTDLFSNEEYYPAFEHQTACDSYWTSVHPEYWTKRHVWEWLQFCCDQYKLDTNCISFCNFNISGLQLCSMTQEEFVEAAGLCGEYLYFILQNIRTQGYSFFNDAEESKATIKDYADSNCLKTSGIKSQDCHSHSRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNAHGWQEDKL

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

53.68 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human ELF5 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00002001-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: ELF5

The protein encoded by this gene is a member of an epithelium-specific subclass of the Ets transcritpion factor family. In addition to its role in regulating the later stages of terminal differentiation of keratinocytes, it appears to regulate a number of epithelium-specific genes found in tissues containing glandular epithelium such as salivary gland and prostate. It has very low affinity to DNA due to its negative regulatory domain at the amino terminus. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. ELF5( AAH29743, 1 a.a. - 256 a.a.) recombinant protein with GST.

Alternate Names

E74-like factor 5, E74-like factor 5 (ets domain transcription factor), Epithelium-restricted ESE-1-related Ets factor, Epithelium-specific Ets transcription factor 2, ESE2ESE-2, ETS-related transcription factor Elf-5

Gene Symbol

ELF5

Additional ELF5 Products

Product Documents for Recombinant Human ELF5 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human ELF5 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews