We have a customer who is looking for recombinant protein to use as positive control in western blot for eNOS/NOS3, eNOS/NOS3 phosphorylated on serine 1177, DDAH1 and DDAH2.

Name: Recombinant Human eNOS GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00004846-Q01

The use of recombinant proteins as positive controls on western blot is primarily driven by the antibody used. Here is a list of proteins we have available. A number of them are partial recombinant proteins and you would need to make sure that your customers immunogen region for the corresponding antibody he/she is using falls within the amino acid range for the recombinant proteins. eNOS: H00004846-Q01, DDAH1: H00023576-P01, NBP1-49442, DDAH2: H00023564-P01. We currently do not have a phosphorylated eNOS recombinant protein.

Recombinant Human eNOS GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00004846-Q01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

View all eNOS Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 61-160 of Human eNOS

Source: Wheat Germ (in vitro)

Amino Acid Sequence: QPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAPEQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAAT

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human eNOS GST (N-Term) Protein

SDS-PAGE: Recombinant Human eNOS GST (N-Term) Protein [H00004846-Q01]

SDS-Page: Recombinant Human eNOS Protein [H00004846-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00004846-Q01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: eNOS

Nitric oxide (NO) is an inorganic, gaseous free radical that carries a variety of messages between cells. Vasorelaxation, neurotransmission and cytotoxicity can all be potentiated through cellular response to NO. NO production is mediated by members of the nitric oxide synthase (NOS) family. NOS catalyzes the oxidization of L-arginine to produce L-citrulline and NO. Two constitutive isoforms, brain or neuronal NOS (b or nNOS, type I) & endothelial cell NOS (eNOS, type III), and one inducible isoform (iNOS, type II), have been cloned. All NOS isoforms contain calmodulin, nicotinamide adenine dinucleotide phosphate (NADPH), flavin adenine dinucleotide (FAD), and flavin mononucleotide (FMN) binding domains. iNOS is found in a variety of cell types including macrophages, hepatocytes, synoviocytes, and smooth muscle cells. Cytokines such as interferon-gamma (IFN), tumor necrosis factor (TNF), interleukin-1 and -2, and lipopolysaccarides (LPS) cause an increase in iNOS mRNA, protein, and activity levels. Protein kinase C-stimulating agents exhibit the same effect on iNOS activity. After cytokine induction, iNOS exhibits a delayed activity response which is then followed by a significant increase in NO production over a long period of time.

Long Name

Endothelial Nitric Oxide Synthase

Alternate Names

NOS3

Gene Symbol