Skip to main content

ETV3 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-17841PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-17841PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ETV3

Source: E. coli

Amino Acid Sequence: SSRFHFPPLDTHSPTNDVQPGRFSASSLTASGQESSNGTDRKTELSELEDGSAADWRRGVDPVSSRNAIGGGGIGHQKR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17841.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-17841PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ETV3

The ETV3 gene encodes an ETS translocation variant 3 protein, that in isoform 1 is 512 amino acids long at 57 kDA and in isoform 2 is 143 amino acids long at nearly 17 kDA. This protein functions in terminal macrophage differentiation as a transcriptional repressor that contributes to growth arrest. It also represses MMP1 promoter activity and interacts with the MYC and DDX20 genes. ETV3 is linked to diseases heart disease, hypertension, ADHD, and conduct disorder.

Alternate Names

bA110J1.4, ETS domain transcriptional repressor PE1, ETS translocation variant 3, ets variant 3, ets variant gene 3, ETS family transcriptional repressor, METS, Mitogenic Ets transcriptional suppressor, PE-1ets variant gene 3, PE1FLJ79173

Gene Symbol

ETV3

Additional ETV3 Products

Product Documents for ETV3 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ETV3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...