Skip to main content

FANCD2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-57171PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-57171PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FANCD2.

Source: E. coli

Amino Acid Sequence: RLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISELREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

164.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57171.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-57171PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: FANCD2

Fanconi Anemia (FA) is an autosomal-recessive cancer-prone disorder characterized by congenital defects, progressive bone marrow failure, increased chromosomal breakage, defective DNA repair and cellular hypersensitivity to mitomycin C. Fanconi Anemia Complementation Group D (FANCD) is comprised of two separate proteins, FANCD1/BRCA2 and FANCD2. LYRIC/MTDH, an RNA binding protein, regulates expression of FANCD2 and FANCD1 (1). FANCD2 is mapped to chromosome 3p25.3, has a theoretical molecular weight of 166 kDa and is localized in the nucleus. FANCD2 is involved in the regulation of DNA-binding transcription factor activity and DNA stability through accurate and efficient pairing of homologs during meiosis to promote repair of double-strand DNA breaks (2). Ubiquitination is required for FANCD2 to bind to chromatin. In response to DNA damage, FANCD2 is monoubiquinated to result in colocalization with other proteins (BRCA1 and BRCA2) involved in homology-directed DNA repair in the nucleus and is deubiquitinated upon DNA repair completion.

References

1. Bi, J., Areecheewakul, S., Li, Y., Yang, S., Zhang, Y., Ebeid, K., . . . Meng, X. (2019). MTDH/AEG-1 downregulation using pristimerin-loaded nanoparticles inhibits Fanconi anemia proteins and increases sensitivity to platinum-based chemotherapy. Gynecol Oncol, 155(2), 349-358. doi:10.1016/j.ygyno.2019.08.014

2. Balcerek, J., Jiang, J., Li, Y., Jiang, Q., Holdreith, N., Singh, B., . . . Tong, W. (2018). Lnk/Sh2b3 deficiency restores hematopoietic stem cell function and genome integrity in Fancd2 deficient Fanconi anemia. Nat Commun, 9(1), 3915. doi:10.1038/s41467-018-06380-1

Long Name

Fanconi Anemia, Complementation Group D2

Alternate Names

FA4, FACD, FAD, FAD2, FANCD

Gene Symbol

FANCD2

Additional FANCD2 Products

Product Documents for FANCD2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for FANCD2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...