FBXW5 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-91892PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-91892PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all FBXW5 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FBXW5.

Source: E. coli

Amino Acid Sequence: PDNRYLYVNSRAWPNGAVVADPMQPPPIAEEIDLLVFDLKTMREVRRALRAHRAYTPNDECFFIFLDVSRDFVASGAEDRHGYIWDRHYNICLARLRHEDVVNSVVFSPQEQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91892.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-91892PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: FBXW5

The FBXW5 gene encodes a F-box/WD repeat-containing protein 5 that exists in two isoforms. Isoform 1 is 556 amino acids long, at nearly 64 kDA while isoform 2 is 377 amino acids long at 42 kDA. This protein encoded by this gene functions in substrate recognition of SCF as well as DCX E3 ubiquitin-protein ligase complexes. It may also work as a negative regulator of MAP3K7/TAK1 signaling in the interleukin-1B signaling pathway. FBXW5 participates in protein chaperonin-mediated protein folding and metabolism as well as the association of TriC/CCT with target proteins during biosynthesis. It is known to interact with genes CUL1, MDFI, SKP1, KRTAP4-12, and UBE2R2. FBXW5 is associated with tuberous sclerosis as well as hepatitis b.

Alternate Names

DKFZp434B205, F-box and WD repeat domain containing 5, F-box and WD-40 domain protein 5, F-box and WD-40 domain-containing protein 5, F-box/WD repeat-containing protein 5, FBW5, MGC20962, RP11-229P13.10, WD repeat-containing F-box protein FBW5

Gene Symbol

FBXW5

Additional FBXW5 Products

Product Documents for FBXW5 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for FBXW5 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.