Fc gamma RIIA/CD32a Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-84589PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-84589PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all Fc gamma RIIA/CD32a Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FCGR2A.

Source: E. coli

Amino Acid Sequence: RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84589.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-84589PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Fc gamma RIIA/CD32a

The FCGR2A gene encodes a low affinity immunoglobulin gamma Fc region receptor II-a protein that in isoform 1 is 317 amino acids long at 35 kDA and at isoform 2 is 316 amino acids long at nearly 35 kDA. These proteins are found on the surface of many immune system response cells that act as a low affinity receptor through encouraging responses against pathogens and soluble antigens. Additionally, it functions to initiate phagocytosis of opsonized antigens. FCGR2A participates in Fc-GammaR pathway, osteoclast differentiation, signaling events controlled by PTP1B, and NFAT in immune response. It is known to interact with genes SYK, FYN, HCK, LGALS3, and PIK3R1. FCGR2A is linked to lupus, thrombocytopenia, b-cell lymphomas, otitis media, adult-onset still's disease, guillain-barre syndrome, asymptomatic dengue, severe acute respiratory syndrome.

Long Name

Fc gamma Receptor II A

Alternate Names

CD32a, FCGR2A, FcgRIIA, FCRIIA

Gene Symbol

FCGR2A

Additional Fc gamma RIIA/CD32a Products

Product Documents for Fc gamma RIIA/CD32a Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Fc gamma RIIA/CD32a Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.