FEM1B Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-86219PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-86219PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all FEM1B Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FEM1B.

Source: E. coli

Amino Acid Sequence: RFAQVFSQMIHLNETVKAPDIECVLRCSVLEIEQSMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86219.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-86219PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: FEM1B

Fas and tumor necrosis factor receptor 1 (TNFR1) are two prototype members in the death receptor family. A novel protein that associates with the intracellular domains of Fas and TNFR1 was recently identified and designated F1Aa and FEM1b (1,2). F1Aa/FEM1b is the homologue of C. elegans sex determining protein FEM-1. FEM-1/F1Aa is cleaved by CED-3 and caspase (3). FEM-1/F1Aa associates with CED-4 and its mammalian homologue Apaf-1 (3). Overexpression of F1Aa induces apoptosis. F1Aa is therefore a novel member of the death receptor associated protein that mediates apoptosis. F1Aa is expressed in a variety of human and mouse tissues.

Alternate Names

DKFZp451E0710, F1AA, F1A-alpha, FEM-1 (C.elegans) homolog b, fem-1 homolog b (C. elegans), FEM1b, FEM1-beta, FEM-1-like death receptor binding protein, Fem-1-like death receptor-binding protein alpha, Fem-1-like in apoptotic pathway protein alpha, FIAA, KIAA0396, protein fem-1 homolog B

Gene Symbol

FEM1B

Additional FEM1B Products

Product Documents for FEM1B Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for FEM1B Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.