Ferroportin/SLC40A1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-49454PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-49454PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all Ferroportin/SLC40A1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Ferroportin/SLC40A1.

Source: E. coli

Amino Acid Sequence: VKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWVSYYN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

62.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49454.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-49454PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Ferroportin/SLC40A1

Ferroportin is a 12-transmembrane domain protein, belonging to the major facilitator superfamily of transporters of small molecules, that is localized to the plasma membrane. Human Ferroportin has a theoretical molecular weight of 62.5 kDa. Ferroportin (FPN1 or SLC40A1) functions as an iron-regulated transporter (highly expressed in placenta, intestine, muscle, spleen, macrophages etc.) and is the receptor for the iron-regulatory hormone, hepcidin. In iron metabolism, FPN1 plays a key role in intestinal iron absorption as well as cellular iron release and mediates iron absorption in the presence of ferroxidases, hephaestin (HP) and/or ceruloplasmin (CP). FPN1 is implicated in iron export from duodenal epithelial cells and in the transfer of iron between maternal and fetal circulation. FPN1 transports iron in the ferrous form whereas plasma transferrin only binds iron's ferric form. Ferroxidases are key players in oxidizing iron transported by FPN1 and without the activity of ferroxidases, FPN1 is internalized followed by degradation. While other cell types utilize the circulating or GPI-linked multicopper ferroxidase CP for FPN1, intestinal cells utilize a membrane-bound HP, a paralog of CP that also show interaction with FPN1 (1).

FPN1 regulation is dependent on the cell type and involves transcriptional, posttranscriptional, and posttranslational mechanisms including hepcidin-mediated endocytosis and proteolysis. Hepcidin controls the concentration of FPN1 in the membrane, with hepcidin deficiency resulting in iron overload (high iron) and hepcidin excess leading to iron restriction and anemia (2). Ferroportin disease or hemochromatosis type 4 (HFE4) is associated with distinct FPN1 variants with either reduced FPN1 cell surface expression/iron export capacity or hepcidin resistance and iron overload (3, 4).

References

1. De Domenico I, Ward DM, Kaplan J. (2011) Hepcidin and ferroportin: the new players in iron metabolism. Semin Liver Dis. 31(3):272-9. PMID: 21901657

2. Drakesmith H, Nemeth E, Ganz T. (2015) Ironing out Ferroportin. Cell Metab. 22(5):777-87. PMID: 26437604

3. Pietrangelo A. (2017) Ferroportin disease: pathogenesis, diagnosis and treatment. Haematologica. 102(12):1972-1984. PMID: 29101207

4. Vlasveld LT, Janssen R, Bardou-Jacquet E, Venselaar H, Hamdi-Roze H, Drakesmith H, Swinkels DW. (2019) Twenty Years of Ferroportin Disease: A Review or An Update of Published Clinical, Biochemical, Molecular, and Functional Features. Pharmaceuticals (Basel). 12(3). pii: E132. PMID: 31505869

Long Name

Solute Carrier Family 40 Member 1

Alternate Names

FPN1, HFE4, IREG1, MST079, MTP1, SLC11A3, SLC40A1

Gene Symbol

SLC40A1

Additional Ferroportin/SLC40A1 Products

Product Documents for Ferroportin/SLC40A1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Ferroportin/SLC40A1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.