FKBP38 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-33440PEP
Key Product Details
Source
E. coli
Conjugate
Unconjugated
Applications
Antibody Competition
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FKBP8.
Source: E. coli
Amino Acid Sequence: YDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGK
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Antibody Competition (10 - 100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33440.
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation and Storage
NBP2-33440PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: FKBP38
FK506 Binding Proteins (FKBPs) are intracellular receptors for the immuno-suppressive drug FK506. The FKBP/FK506 complex exerts its immunosuppressive effects by inhibiting calcineurin, a calcium- and calmodulin-dependent serine/threonine phosphatase that functions as a critical signaling molecule during T cell activation.
FKBP38, also known as FKBP8, is a 355 amino acid (aa) protein with a calculated molecular weight of 38.7 kDa and an apparent molecular mass of ~60 - 64 kDa in SDS-PAGE. FKBP38 binds to and inhibits calcineurin even in the absence of FK506, indicating that FKBP38 is a constitutively active inhibitor of calcineurin. Additionally, FKBP38 immunoprecipitates with Bcl-2 and Bcl-xL, suggesting that FKBP38 may regulate apoptosis by anchoring Bcl-2 and Bcl-xL to mitochondrial membranes. Mouse FKBP38 shares 94% and 87% sequence identity with human and rat FKBP38, respectively.
Long Name
38 kDa FK506 Binding Protein
Alternate Names
FKBP8
Gene Symbol
FKBP8
Additional FKBP38 Products
Product Documents for FKBP38 Recombinant Protein Antigen
Product Specific Notices for FKBP38 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...