FKBP51/FKBP5 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-33944PEP
Key Product Details
Source
E. coli
Conjugate
Unconjugated
Applications
Antibody Competition
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FKBP5.
Source: E. coli
Amino Acid Sequence: TDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNG
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Antibody Competition (10 - 100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33944.
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation and Storage
NBP2-33944PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: FKBP51
FK506 binding proteins (FKBPs) are intracellular receptors for the immunosuppressive drug FK506. The FKBP/FK506 complex inhibits calcineurin, a calcium/calmodulin dependent Ser/Thr phosphatase that functions as a critical signaling molecule during T cell activation. FKBP38 functions as an anti-apoptotic molecule by modulating the intracellular distribution of Bcl-2 and Bcl-xL.
FK506 binding protein, 51 kDa molecular weight (FKBP51) is a peptidyl-prolyl isomerase that catalyzes the transition between cis- and trans- proline residues critical for proper folding of proteins. The macrolide immunosuppressants FK506 and Rapamycin are FKBP51 inhibitors. FKBP51 levels are induced by glucocorticoids. It associates with HSP90 complexes that are critical for the proper folding of steroid receptors. Single nucleotide polymorphisms in FKBP51 have been associated with major depression and hyper-responsiveness to antidepressants.
Long Name
51 kDa FK506 Binding Protein
Alternate Names
Dit1, FKBP5, FKBP54, Ptg-10
Gene Symbol
FKBP5
Additional FKBP51 Products
Product Documents for FKBP51/FKBP5 Recombinant Protein Antigen
Product Specific Notices for FKBP51/FKBP5 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...