FKBP51/FKBP5 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP1-84677PEP
Key Product Details
Source
Tag
Conjugate
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: RRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEP
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
Protein / Peptide Type
Formulation, Preparation and Storage
NBP1-84677PEP
Formulation | PBS and 1M Urea, pH 7.4. |
Preservative | No Preservative |
Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: FKBP51
FK506 binding proteins (FKBPs) are intracellular receptors for the immunosuppressive drug FK506. The FKBP/FK506 complex inhibits calcineurin, a calcium/calmodulin dependent Ser/Thr phosphatase that functions as a critical signaling molecule during T cell activation. FKBP38 functions as an anti-apoptotic molecule by modulating the intracellular distribution of Bcl-2 and Bcl-xL.
FK506 binding protein, 51 kDa molecular weight (FKBP51) is a peptidyl-prolyl isomerase that catalyzes the transition between cis- and trans- proline residues critical for proper folding of proteins. The macrolide immunosuppressants FK506 and Rapamycin are FKBP51 inhibitors. FKBP51 levels are induced by glucocorticoids. It associates with HSP90 complexes that are critical for the proper folding of steroid receptors. Single nucleotide polymorphisms in FKBP51 have been associated with major depression and hyper-responsiveness to antidepressants.
Long Name
Alternate Names
Gene Symbol
Additional FKBP51 Products
Product Documents for FKBP51/FKBP5 Recombinant Protein Antigen
Product Specific Notices for FKBP51/FKBP5 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.