Recombinant Human Flavin containing monooxygenase 4 GST (N-Term) Protein

Name: Recombinant Human Flavin containing monooxygenase 4 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00002329-Q01

Novus Biologicals, part of Bio-Techne | Catalog # H00002329-Q01

Submit a review

Product Datasheet / COA / SDS

Discontinued Product

H00002329-Q01 has been discontinued. View all Flavin containing monooxygenase 4 products.

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

View all Flavin containing monooxygenase 4 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 206-301 of Human Flavin containing monooxygenase 4

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TAAQVLLSTRTGTWVLGRSSDWGYPYNMMVTRRCCSFIAQVLPSRFLNWIQERKLNKRFNHEDYGLSITKGKKAKFIVNDELPNCILCGAITMKTS

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images

SDS-PAGE: Recombinant Human Flavin containing monooxygenase 4 GST (N-Term) Protein [H00002329-Q01]

SDS-Page: Recombinant Human Flavin containing monooxygenase 4 Protein [H00002329-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00002329-Q01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Flavin containing monooxygenase 4

Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. [provided by RefSeq]

Alternate Names

dimethylaniline monooxygenase [N-oxide-forming] 4, Dimethylaniline oxidase 4, EC 1.14.13.8, flavin containing monooxygenase 4, FMO 4, FMO2, Hepatic flavin-containing monooxygenase 4

Gene Symbol

FMO4

Additional Flavin containing monooxygenase 4 Products

Product Documents

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews