Follistatin Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-21237PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-21237PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all Follistatin Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Follistatin

Source: E.coli

Amino Acid Sequence: LCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPIS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21237. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-21237PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Follistatin

FST, also known as Follistatin, has a 344 amino acid long isoform that is 38 kDa and a short 317 amino acid that is 35 kDa, functions as an activin antagonist binding directly to it and inhibits the biosynthesis and secretion of pituitary follicle stimulating hormone (FSH). Studies of this protein are being performed in relation to polycystic ovary syndrome, pituitary adenoma, insulin resistance, Down syndrome, plasmacytoma, lymphocytic leukemia, pituitary tumor infertility, endometrial carcinoma, teratocarcinoma, azoospermia, meningitis, hepatocellular carcinoma, ovarian carcinoma, liver disease, endometriosis, prostate carcinoma, prostatitis, ovarian cancer, and adenoma. This protein has been also shown to have interactions with ANG, DIP2A, BMP4, FN1, and TXN in signal transduction activin A signaling regulation and TGF-beta signaling pathways.

Alternate Names

FS, FST

Gene Symbol

FST

Additional Follistatin Products

Product Documents for Follistatin Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Follistatin Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.