Skip to main content

Recombinant Human FOXG1 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00002290-Q01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00002290-Q01-10ug
H00002290-Q01-25ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 183-291 of Human FOXG1B

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGAR

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human FOXG1 GST (N-Term) Protein

SDS-PAGE: Recombinant Human FOXG1 GST (N-Term) Protein [H00002290-Q01]

SDS-PAGE: Recombinant Human FOXG1 GST (N-Term) Protein [H00002290-Q01]

SDS-Page: Recombinant Human FOXG1 Protein [H00002290-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00002290-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: FOXG1

Transcription repression factor which plays an important role in the establishment of the regional subdivision of the developing brain and in the development of the telencephalon. This gene participates in signal transduction Activin A signaling regulation, TGF-beta receptor signaling pathway, transcription factors in neurogenesis, as well as regulation of nuclear SMAD2/3 signaling. It is thought to interact with genes FOXO1, FOXO3, FOXO4, SMAD2, and SMAD3. FOXG1 is associated with diseases such as melanoma, neuronitis, glioblastoma, purpura, west syndrome, rett syndrome, medulloblastoma, hypotonia, retinitis, maternal uniparental disomy, chromosome 14, intellectual disabilities, brain malformations, multiple sclerosis, and lupus.

Alternate Names

BF-1, BF1HBF-2, BF2, BF-2, Brain factor 1, Brain factor 2, FHKL3, FKHL1forkhead-like 1, FKHL2, FKHL3, FKHL4, forkhead box G1, forkhead box G1A, forkhead box G1B, forkhead box G1C, Forkhead box protein G1A, Forkhead box protein G1B, Forkhead box protein G1C, forkhead-like 3, forkhead-like 4, Forkhead-related protein FKHL1, Forkhead-related protein FKHL2, Forkhead-related protein FKHL3, FOXG1A, FOXG1Bforkhead-like 2, FOXG1C, HBF-1, hBF-2, HBF-3, HFK1HBF-G2, HFK2HBF2, HFK3KHL2, oncogene QIN, QINFKH2forkhead box protein G1

Gene Symbol

FOXG1

Additional FOXG1 Products

Product Documents for Recombinant Human FOXG1 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human FOXG1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...