Fucosyltransferase 3/FUT3 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-54732PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-54732PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all Fucosyltransferase 3/FUT3 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FUT3.

Source: E. coli

Amino Acid Sequence: KDLARYLQELDKDHARYLSYFRWRETLRPRSFSWAL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54732.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-54732PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Fucosyltransferase 3/FUT3

Because N-, O-glycans and glycolipids are frequently fucosylated at terminal sites, fucose is often found to be essential for sugar epitope and lectin ligand generation. Well-known fucose containing structures include Lewis structures and ABO blood group antigens. Lewis structures are key elements involved in leukocyte homing and extravasation process and thus are essential for lymphocyte maturation and natural defense functions. Fucose containing glycans also play essential roles in cell signaling and development. So far, more than 10 fucosyltransferases have been cloned from the human genome. FUT1 and FUT2 are alpha 1-2 fucosyltransferases and are responsible for ABO blood group antigen synthesis. FUT3, FUT4, FUT5, FUT6, FUT7 and FUT9 are responsible for Lewis structure generation through their alpha 1-3 or alpha 1-4 fucosyltransferases activities. FUT3, also known as Lewis blood group fucosyltransferase, is unique by having both strong alpha 1-3 and alpha 1-4 fucosyltransferase activities. FUT3 has high homology with FUT5 and FUT6 due to gene duplication. FUT7 is exclusively responsible for biosynthesis of sialyl Lewis X epitope in leukocytes and high endothelial venule cells. FUT8 is an alpha 1-6 fucosyltransferase that adds a fucose to the chitobiose core of N-glycans. Predicted as type II transmembrane proteins and Golgi enzymes, some of the fucosyltransferases can also be found in plasma. R&D Systems rhFUTs correspond to the luminal domains.

Alternate Names

CD174, FT3B, FucT-III, FUT3, Les, Lewis FT

Gene Symbol

FUT3

Additional Fucosyltransferase 3/FUT3 Products

Product Documents for Fucosyltransferase 3/FUT3 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Fucosyltransferase 3/FUT3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.