FXYD3 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-81256PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-81256PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all FXYD3 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FXYD3.

Source: E. coli

Amino Acid Sequence: MSEWRSSGEQAGRGWGSPPLTTQLSPTGAKCKCKFGQKSGHHPGETPPLITPGSAQS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81256.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-81256PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: FXYD3

FXYD3, also known as FXYD domain-containing ion transport regulator 3, consists of 3 isoforms, a 87 amino acid isoform that is 9 kDa, a 113 amino acid isoform that is 12 kDa, and a 144 amino acid that is 15 kDa; is membrane located, functions as an inducer of a hyperpolarization-activated chloride current when expressed in Xenopus oocytes, and may be a modulator capable of activating endogenous oocyte channels. Current research is being performed on several diseases and disorders including adenocarcinoma, pancreatic, ductal adenocarcinoma, intrahepatic cholangiocarcinoma, colorectal cancer, cholangiocarcinoma prostate carcinoma, melanoma, pancreatic cancer, pancreatitis, prostate cancer, breast cancer, and prostatitis. The FXYD3 protein has also shown an interaction with SERBP1, FBXL12, NR4A1, MAPK6 and NUDT3, in the regulation of catalytic activity, ion transport, and chloride transport pathways.

Alternate Names

Chloride conductance inducer protein Mat-8, FXYD domain containing ion transport regulator 3, FXYD domain-containing ion transport regulator 3, Mammary tumor 8 kDa protein, MAT8MAT-8, Phospholemman-like, phospholemman-like protein, PLMLMGC111076

Gene Symbol

FXYD3

Additional FXYD3 Products

Product Documents for FXYD3 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for FXYD3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.